PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv1_019790_iszi.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family MIKC_MADS
Protein Properties Length: 263aa    MW: 29815.7 Da    PI: 7.6841
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv1_019790_iszi.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.87.7e-30959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krien++ rqvtfskRr+g+lKKA+ELSvLCdae+a+i+fss+gklye+ss
  Bv1_019790_iszi.t1  9 KRIENNISRQVTFSKRRTGLLKKAKELSVLCDAEIALIVFSSRGKLYEFSS 59
                        79***********************************************96 PP

2K-box87.13.4e-2987176897
               K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                         ++ ea+++s+ qe+a L+++ e+L+r qRh+lGedL+sLslkeLq+Le+qLe++l + R++K +l+ eq++ l++ e++l + nk+L+ +
  Bv1_019790_iszi.t1  87 HAIEAQTQSWLQEIAHLESQCESLKRAQRHMLGEDLGSLSLKELQHLEKQLESALAQTRARKAQLMAEQMDALRRSERKLGDLNKELKLR 176
                         367889********************************************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.744161IPR002100Transcription factor, MADS-box
SMARTSM004323.4E-39160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-31283IPR002100Transcription factor, MADS-box
CDDcd002653.30E-41273No hitNo description
PRINTSPR004048.5E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.3E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004048.5E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004048.5E-313859IPR002100Transcription factor, MADS-box
PfamPF014865.0E-2691176IPR002487Transcription factor, K-box
PROSITE profilePS5129715.19193183IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048437Biological Processfloral organ development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MGRGKVELKR IENNISRQVT FSKRRTGLLK KAKELSVLCD AEIALIVFSS RGKLYEFSSI  60
ECLPKTIERY QRCGNNIELH HHNHQDHAIE AQTQSWLQEI AHLESQCESL KRAQRHMLGE  120
DLGSLSLKEL QHLEKQLESA LAQTRARKAQ LMAEQMDALR RSERKLGDLN KELKLRVGDQ  180
GHGFRPILDS NGCIPFIHQS QSTSFEYDPV TLQIGSYKPE PVVLEIGYAP HYPSHEDEGP  240
SNGNQRAGLG SDSTNFHQAG WLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_D8e-188817915103Developmental protein SEPALLATA 3
4ox0_C8e-188817915103Developmental protein SEPALLATA 3
4ox0_B8e-188817915103Developmental protein SEPALLATA 3
4ox0_A8e-188817915103Developmental protein SEPALLATA 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00315DAPTransfer from AT2G45650Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010692324.10.0PREDICTED: truncated transcription factor CAULIFLOWER A isoform X1
TrEMBLA0A0J8EAU80.0A0A0J8EAU8_BETVU; Uncharacterized protein
STRINGVIT_15s0048g01270.t013e-83(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45650.13e-70AGAMOUS-like 6